PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim11g020620.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family M-type_MADS
Protein Properties Length: 343aa    MW: 38747.9 Da    PI: 5.4207
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim11g020620.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF44.91.4e-141150342
                        --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
              SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                        i+++ +r  t+  R++g++KK +ELS+LCd++++++i+ +
  Sopim11g020620.0.1 11 IQDDKKRMKTLVTRKAGLFKKISELSILCDIKACMLIYDE 50
                        8999*********************************954 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554552.09E-18176IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.03152IPR002100Transcription factor, MADS-box
SMARTSM004322.9E-13161IPR002100Transcription factor, MADS-box
CDDcd002663.12E-19276No hitNo description
PfamPF003192.7E-131152IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MGRSKIKVEL IQDDKKRMKT LVTRKAGLFK KISELSILCD IKACMLIYDE GNNNNCEMWP  60
NDPNELINLY KNQPFEGPTK RGKTLSGDEI KVEKDPDSRF DYFENNEKKK ADAIQVEKYP  120
TWDSRFDYLS QKELQNLAGV LENRMENAKG RIELLKSMNG SCSLSHQQQI WDYNNLMNQT  180
TTLSNNNLFQ SNIPISSTVN SMGAGMDYHF CNANYCKMNE SENWYGVGSS LTMMQHNMAN  240
NGIGSSSTIL HLMGDDYGII DSSSTMMLPM GNNEIGSSST MQQPMYQYPF MYNGSTHVIG  300
SSSTMQPPMG QYPFTNNDDS TGILVQVQQC SLWGIIMRLV QL*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755230.0HG975523.1 Solanum lycopersicum chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010312953.10.0PREDICTED: MADS-box transcription factor 2-like
TrEMBLK4D7140.0K4D714_SOLLC; Uncharacterized protein
STRINGSolyc11g020620.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA63421232
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.11e-15M-type_MADS family protein